BAF57/SMARCE1 Rabbit mAb, Clone: [ARC0839], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA3814S
Artikelname: BAF57/SMARCE1 Rabbit mAb, Clone: [ARC0839], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA3814S
Hersteller Artikelnummer: CNA3814S
Alternativnummer: MBL-CNA3814S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 2-100 of human BAF57/SMARCE1 (NP_003070.3).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0839]
Molekulargewicht: 47kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: SKRPSYAPPPTPAPATQMPSTPGFVGYNPYSHLAYNNYRLGGNPGTNSRVTASSGITIPKPPKPPDKPLMPYMRYSRKVWDQVKASNPDLKLWEIGKII
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 2-100 of human BAF57/SMARCE1 (NP_003070.3).
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200