53BP1 Rabbit mAb, Clone: [ARC0850], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA3859S
Artikelname: 53BP1 Rabbit mAb, Clone: [ARC0850], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA3859S
Hersteller Artikelnummer: CNA3859S
Alternativnummer: MBL-CNA3859S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human 53BP1 (Q12888).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0850]
Molekulargewicht: 214kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MDPTGSQLDSDFSQQDTPCLIIEDSQPESQVLEDDSGSHFSMLSRHLPNLQTHKENPVLDVVSNPEQTAGEERGDGNSGFNEHLKENKVADPVDSSNLDT
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human 53BP1 (Q12888).
Application Verdünnung: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200