PKA RIIalpha (PRKAR2A) Rabbit mAb, Clone: [ARC0860], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA3889S
Artikelname: PKA RIIalpha (PRKAR2A) Rabbit mAb, Clone: [ARC0860], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA3889S
Hersteller Artikelnummer: CNA3889S
Alternativnummer: MBL-CNA3889S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 312-404 of human PKA RIIalpha (PRKAR2A) (P13861).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0860]
Molekulargewicht: 46kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: SRTKSNKDGGNQEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGSSVDLGNLGQ
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 312-404 of human PKA RIIalpha (PRKAR2A) (P13861).
Application Verdünnung: WB: WB,1:500 - 1:1000