HMGCS1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA3916T
Artikelname: HMGCS1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA3916T
Hersteller Artikelnummer: CNA3916T
Alternativnummer: MBL-CNA3916T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 241-520 of human HMGCS1 (NP_002121.4).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 57kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: HAQWQKEGNDKDFTLNDFGFMIFHSPYCKLVQKSLARMLLNDFLNDQNRDKNSIYSGLEAFGDVKLEDTYFDRDVEKAFMKASSELFSQKTKASLLVSNQNGNMYTSSVYGSLASVLAQYSPQQLAGKRIGVFSYGSGLAATLYSLKVTQDATPGSALDKITASLCDLKSRLDSRTGVAPDVFAENMKLREDTHHLVNYIPQGSIDSLFEGTWYLVRVDEKHRRTYARRPTPNDDTLDEGVGLVHSNIATEHIP
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 241-520 of human HMGCS1 (NP_002121.4).
Application Verdünnung: WB: WB,1:1000 - 1:2000|IF/ICC,1:50 - 1:200