PFKFB3 Rabbit mAb, Clone: [ARC50569], Unconjugated, Monoclonal
Artikelnummer:
MBL-CNA3934P
| Artikelname: |
PFKFB3 Rabbit mAb, Clone: [ARC50569], Unconjugated, Monoclonal |
| Artikelnummer: |
MBL-CNA3934P |
| Hersteller Artikelnummer: |
CNA3934P |
| Alternativnummer: |
MBL-CNA3934P |
| Hersteller: |
MBL |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human, Mouse |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 400-500 of human PFKFB3 (NP_004557.1). |
| Konjugation: |
Unconjugated |
| Klonalität: |
Monoclonal |
| Klon-Bezeichnung: |
[ARC50569] |
| Molekulargewicht: |
60kDa |
| Puffer: |
PBS with 0.05% proclin300,0.05% BSA,50% glycerol |
| Quelle: |
Rabbit |
| Reinheit: |
Affinity purification |
| Formulierung: |
PBS with 0.05% proclin300,0.05% BSA,50% glycerol |
| Sequenz: |
LDKSAEEMPYLKCPLHTVLKLTPVAYGCRVESIYLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHVASTSAALPSCLPPEVPT |
| Target-Kategorie: |
A synthetic peptide corresponding to a sequence within amino acids 400-500 of human PFKFB3 (NP_004557.1). |
| Application Verdünnung: |
WB: WB,1:100 - 1:500 |
