KRT81 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA3940T
Artikelname: KRT81 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA3940T
Hersteller Artikelnummer: CNA3940T
Alternativnummer: MBL-CNA3940T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 350-450 of human KRT81 (NP_002272.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 55kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: VAQSEQQGEAALSDARCKLAELEGALQKAKQDMACLIREYQEVMNSKLGLDIEIATYRRLLEGEEQRLCEGIGAVNVCVSSSRGGVVCGDLCVSGSRPVTG
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 350-450 of human KRT81 (NP_002272.2).
Application Verdünnung: WB: WB,1:500 - 1:1000