LXRalpha Rabbit mAb, Clone: [ARC0877], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA3974S
Artikelname: LXRalpha Rabbit mAb, Clone: [ARC0877], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA3974S
Hersteller Artikelnummer: CNA3974S
Alternativnummer: MBL-CNA3974S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LXRalpha (Q13133).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0877]
Molekulargewicht: 50kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSAGGTAGVGLEAAEPTALLTRAEPPSEPTEIRPQKRKKGPAPKMLGNELCSV
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LXRalpha (Q13133).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200