CENPC Rabbit mAb, Clone: [ARC2097], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA3975S
Artikelname: CENPC Rabbit mAb, Clone: [ARC2097], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA3975S
Hersteller Artikelnummer: CNA3975S
Alternativnummer: MBL-CNA3975S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 380-520 of human CENPC (Q03188).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2097]
Molekulargewicht: 107kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: VLDTSYALIGETVNNYRSTKYEMYSKNAEKPSRSKRTIKQKQRRKFMAKPAEEQLDVGQSKDENIHTSHITQDEFQRNSDRNMEEHEEMGNDCVSKKQMPPVGSKKSSTRKDKEESKKKRFSSESKNKLVPEEVTSTVTKS
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 380-520 of human CENPC (Q03188).
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200