Myelin oligodendrocyte glycoprotein Rabbit mAb, Clone: [ARC0879], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA3992S
Artikelname: Myelin oligodendrocyte glycoprotein Rabbit mAb, Clone: [ARC0879], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA3992S
Hersteller Artikelnummer: CNA3992S
Alternativnummer: MBL-CNA3992S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PI3 Kinase p85 alpha (P27986).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0879]
Molekulargewicht: 28kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MASLSRPSLPSCLCSFLLLLLLQVSSSYAGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTEL
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PI3 Kinase p85 alpha (P27986).
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200