NDUFAF1 Rabbit mAb, Clone: [ARC2091], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA4007S
Artikelname: NDUFAF1 Rabbit mAb, Clone: [ARC2091], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA4007S
Hersteller Artikelnummer: CNA4007S
Alternativnummer: MBL-CNA4007S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human NDUFAF1 (Q9Y375).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2091]
Molekulargewicht: 38kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MALVHKLLRGTYFLRKFSKPTSALYPFLGIRFAEYSSSLQKPVASPGKASSQRKTEGDLQGDHQKEVALDITSSEEKPDVSFDKAIRDEAIYHFRLLKDEIVDHWRGPEGHPLHEVLLEQAKVVWQFRGKEDLDKWTVTSDKTIGGRSEV
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human NDUFAF1 (Q9Y375).
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200