MBD2 Rabbit mAb, Clone: [ARC2691], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA4032S
Artikelname: MBD2 Rabbit mAb, Clone: [ARC2691], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA4032S
Hersteller Artikelnummer: CNA4032S
Alternativnummer: MBL-CNA4032S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MBD2 (Q9UBB5).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2691]
Molekulargewicht: 43kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: GGSGLGGDGGGCGGGGSGGGGAPRREPVPFPSGSAGPGPRGPRATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNT
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MBD2 (Q9UBB5).
Application Verdünnung: WB: WB,1:500 - 1:1000