CDCA5 Rabbit mAb, Clone: [ARC2096], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA4044S
Artikelname: CDCA5 Rabbit mAb, Clone: [ARC2096], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA4044S
Hersteller Artikelnummer: CNA4044S
Alternativnummer: MBL-CNA4044S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 153-252 of human CDCA5 (Q96FF9).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2096]
Molekulargewicht: 28kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: GSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVPRVCAKPWAPDMTLPGISPPPEKQKRKKKKMPEILKTELDEWAAAMNAEFEAAEQFDLLVE
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 153-252 of human CDCA5 (Q96FF9).
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200