SMMHC/MYH11 Rabbit mAb, Clone: [ARC51911], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA4064P
Artikelname: SMMHC/MYH11 Rabbit mAb, Clone: [ARC51911], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA4064P
Hersteller Artikelnummer: CNA4064P
Alternativnummer: MBL-CNA4064P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1160-1313 of human SMMHC/MYH11 (NP_002465.1).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC51911]
Molekulargewicht: 227kDa
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: DSTATQQELRAKREQEVTVLKKALDEETRSHEAQVQEMRQKHAQAVEELTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEAQVQELQSKCSDGERARAELNDKVHKLQNEVESVTGMLNEAEGKAIKLAKDVASL
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1160-1313 of human SMMHC/MYH11 (NP_002465.1).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:2000 - 1:10000|IF/ICC,1:50 - 1:200