Cyclin H Rabbit mAb, Clone: [ARC0893], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA4076S
Artikelname: Cyclin H Rabbit mAb, Clone: [ARC0893], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA4076S
Hersteller Artikelnummer: CNA4076S
Alternativnummer: MBL-CNA4076S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 224-323 of human Cyclin H (P51946).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0893]
Molekulargewicht: 38kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: AGITMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 224-323 of human Cyclin H (P51946).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200