SRSF1/SF2/ASF Rabbit mAb, Clone: [ARC51453], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA4091P
Artikelname: SRSF1/SF2/ASF Rabbit mAb, Clone: [ARC51453], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA4091P
Hersteller Artikelnummer: CNA4091P
Alternativnummer: MBL-CNA4091P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human SRSF1/SF2/ASF (NP_008855.1).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC51453]
Molekulargewicht: 28kDa
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: GGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSP
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human SRSF1/SF2/ASF (NP_008855.1).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200