Lipoprotein lipase (LPL) Rabbit mAb, Clone: [ARC0904], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA4115S
Artikelname: Lipoprotein lipase (LPL) Rabbit mAb, Clone: [ARC0904], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA4115S
Hersteller Artikelnummer: CNA4115S
Alternativnummer: MBL-CNA4115S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 376-475 of human Lipoprotein lipase (LPL) (P06858).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0904]
Molekulargewicht: 53kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: IPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWKSDSYFSWSDWWSSPGFAIQKIRVKAGETQKKVIFCSREKVSHLQKGKAPAVFVKCHDKSLNKKSG
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 376-475 of human Lipoprotein lipase (LPL) (P06858).
Application Verdünnung: WB: WB,1:500 - 1:2000