Staufen Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA4131S
Artikelname: Staufen Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA4131S
Hersteller Artikelnummer: CNA4131S
Alternativnummer: MBL-CNA4131S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 426-577 of human Staufen (NP_059347.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 63kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: QAVGVSQGHHTKDFTRAAPNPAKATVTAMIARELLYGGTSPTAETILKNNISSGHVPHGPLTRPSEQLDYLSRVQGFQVEYKDFPKNNKNEFVSLINCSSQPPLISHGIGKDVESCHDMAALNILKLLSELDQQSTEMPRTGNGPMSVCGRC
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 426-577 of human Staufen (NP_059347.2).
Application Verdünnung: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:100