WNK1 Rabbit mAb, Clone: [ARC0932], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA4223S
Artikelname: WNK1 Rabbit mAb, Clone: [ARC0932], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA4223S
Hersteller Artikelnummer: CNA4223S
Alternativnummer: MBL-CNA4223S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human WNK1 (Q9H4A3).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0932]
Molekulargewicht: 251kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MSGGAAEKQSSTPGSLFLSPPAPAPKNGSSSDSSVGEKLGAAAADAVTGRTEEYRRRRHTMDKDSRGAAATTTTTEHRFFRRSVICDSNATALELPGLPL
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human WNK1 (Q9H4A3).
Application Verdünnung: WB: WB,1:500 - 1:1000