CD83 Rabbit mAb, Clone: [ARC0935], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA4234S
Artikelname: CD83 Rabbit mAb, Clone: [ARC0935], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA4234S
Hersteller Artikelnummer: CNA4234S
Alternativnummer: MBL-CNA4234S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD83 (Q01151).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0935]
Molekulargewicht: 23kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSC
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD83 (Q01151).
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200