CD26/DPP4 Rabbit mAb, Clone: [ARC0939], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA4252S
Artikelname: CD26/DPP4 Rabbit mAb, Clone: [ARC0939], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA4252S
Hersteller Artikelnummer: CNA4252S
Alternativnummer: MBL-CNA4252S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 667-766 of human CD26/DPP4 (P27487).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0939]
Molekulargewicht: 88kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: TERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQSAQISKALVDVGVDFQAMWYTDEDHGIASSTAHQHIYTHMSHFIKQCFSLP
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 667-766 of human CD26/DPP4 (P27487).
Application Verdünnung: WB: WB,1:500 - 1:1000