Placental alkaline phosphatase (PLAP) Rabbit mAb, Clone: [ARC0961], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA4304S
Artikelname: Placental alkaline phosphatase (PLAP) Rabbit mAb, Clone: [ARC0961], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA4304S
Hersteller Artikelnummer: CNA4304S
Alternativnummer: MBL-CNA4304S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Placental alkaline phosphatase (PLAP) (P05187).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0961]
Molekulargewicht: 58kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: ALSKTYNVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASA
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Placental alkaline phosphatase (PLAP) (P05187).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:500 - 1:1000