GATA4 Rabbit mAb, Clone: [ARC51718], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA4306P
Artikelname: GATA4 Rabbit mAb, Clone: [ARC51718], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA4306P
Hersteller Artikelnummer: CNA4306P
Alternativnummer: MBL-CNA4306P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 343-442 of human GATA4 (NP_002043.2).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC51718]
Molekulargewicht: 45kDa
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: ASGASSNSSNATTSSSEEMRPIKTEPGLSSHYGHSSSVSQTFSVSAMSGHGPSIHPVLSALKLSPQGYASPVSQSPQTSSKQDSWNSLVLADSHGDIITA
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 343-442 of human GATA4 (NP_002043.2).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:100 - 1:500