Peroxiredoxin 2 (PRDX2) Rabbit mAb, Clone: [ARC0963], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA4308S
Artikelname: Peroxiredoxin 2 (PRDX2) Rabbit mAb, Clone: [ARC0963], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA4308S
Hersteller Artikelnummer: CNA4308S
Alternativnummer: MBL-CNA4308S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Peroxiredoxin 2 (PRDX2) (P32119).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0963]
Molekulargewicht: 22kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLN
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Peroxiredoxin 2 (PRDX2) (P32119).
Application Verdünnung: WB: WB,1:500 - 1:2000