Histone H1.0 Rabbit mAb, Clone: [ARC1059], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA4342S
Artikelname: Histone H1.0 Rabbit mAb, Clone: [ARC1059], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA4342S
Hersteller Artikelnummer: CNA4342S
Alternativnummer: MBL-CNA4342S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H1.0 (P07305).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1059]
Molekulargewicht: 21kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDE
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H1.0 (P07305).
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200