SUZ12 Rabbit mAb, Clone: [ARC0972], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA4348S
Artikelname: SUZ12 Rabbit mAb, Clone: [ARC0972], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA4348S
Hersteller Artikelnummer: CNA4348S
Alternativnummer: MBL-CNA4348S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-96 of human SUZ12 (Q15022).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0972]
Molekulargewicht: 83kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSAAAAAGAAVLPVKKPKMEHVQADHELFLQAFEKPTQI
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1-96 of human SUZ12 (Q15022).
Application Verdünnung: WB: WB,1:500 - 1:1000