OTX2 Rabbit mAb, Clone: [ARC0973], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA4351S
Artikelname: OTX2 Rabbit mAb, Clone: [ARC0973], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA4351S
Hersteller Artikelnummer: CNA4351S
Alternativnummer: MBL-CNA4351S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 190-289 of human OTX2 (P32243).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0973]
Molekulargewicht: 32kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: AGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 190-289 of human OTX2 (P32243).
Application Verdünnung: WB: WB,1:500 - 1:2000