DCAMKL1/DCLK1 Rabbit mAb, Clone: [ARC0984], Unconjugated, Monoclonal
Artikelnummer:
MBL-CNA4372S
Artikelname: |
DCAMKL1/DCLK1 Rabbit mAb, Clone: [ARC0984], Unconjugated, Monoclonal |
Artikelnummer: |
MBL-CNA4372S |
Hersteller Artikelnummer: |
CNA4372S |
Alternativnummer: |
MBL-CNA4372S |
Hersteller: |
MBL |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Spezies Reaktivität: |
Human, Mouse, Rat |
Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 600-700 of human DCAMKL1/DCLK1 (O15075). |
Konjugation: |
Unconjugated |
Klonalität: |
Monoclonal |
Klon-Bezeichnung: |
[ARC0984] |
Molekulargewicht: |
82kDa |
Puffer: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
Quelle: |
Rabbit |
Reinheit: |
Affinity purification |
Formulierung: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
Sequenz: |
QILMGQVDFPSPYWDNVSDSAKELITMMLLVDVDQRFSAVQVLEHPWVNDDGLPENEHQLSVAGKIKKHFNTGPKPNSTAAGVSVIATTALDKERQVFRRR |
Target-Kategorie: |
A synthetic peptide corresponding to a sequence within amino acids 600-700 of human DCAMKL1/DCLK1 (O15075). |
Application Verdünnung: |
WB: WB,1:500 - 1:1000 |