[KO Validated] CRMP2/DPYSL2 Rabbit mAb, Clone: [ARC1123], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA4411S
Artikelname: [KO Validated] CRMP2/DPYSL2 Rabbit mAb, Clone: [ARC1123], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA4411S
Hersteller Artikelnummer: CNA4411S
Alternativnummer: MBL-CNA4411S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 473-572 of human CRMP2/DPYSL2 (Q16555).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1123]
Molekulargewicht: 62kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: PFPDFVYKRIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVAPPGGRANITSLG
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 473-572 of human CRMP2/DPYSL2 (Q16555).
Application Verdünnung: WB: WB,1:500 - 1:5000|IF/ICC,1:50 - 1:200