APOL1 Rabbit mAb, Clone: [ARC1124], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA4412S
Artikelname: APOL1 Rabbit mAb, Clone: [ARC1124], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA4412S
Hersteller Artikelnummer: CNA4412S
Alternativnummer: MBL-CNA4412S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 303-398 of human APOL1 (O14791).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1124]
Molekulargewicht: 44kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: RPRVTEPISAESGEQVERVNEPSILEMSRGVKLTDVAPVSFFLVLDVVYLVYESKHLHEGAKSETAEELKKVAQELEEKLNILNNNYKILQADQEL
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 303-398 of human APOL1 (O14791).
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200