Thioredoxin 2 (Trx2/TXN2) Rabbit mAb, Clone: [ARC1003], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA4424S
Artikelname: Thioredoxin 2 (Trx2/TXN2) Rabbit mAb, Clone: [ARC1003], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA4424S
Hersteller Artikelnummer: CNA4424S
Alternativnummer: MBL-CNA4424S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 67-166 of human Thioredoxin 2 (Trx2/TXN2) (Trx2/TXN2) (Q99757).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1003]
Molekulargewicht: 18kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: GPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 67-166 of human Thioredoxin 2 (Trx2/TXN2) (Trx2/TXN2) (Q99757).
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200