IGF2BP3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA4444S
Artikelname: IGF2BP3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA4444S
Hersteller Artikelnummer: CNA4444S
Alternativnummer: MBL-CNA4444S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human IGF2BP3 (NP_006538.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 64kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: GRVIGKGGKTVNELQNLSSAEVVVPRDQTPDENDQVVVKITGHFYACQVAQRKIQEILTQVKQHQQQKALQSGPPQSRRK
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human IGF2BP3 (NP_006538.2).
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:50 - 1:200