STAT4 Rabbit mAb, Clone: [ARC1071], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA4523S
Artikelname: STAT4 Rabbit mAb, Clone: [ARC1071], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA4523S
Hersteller Artikelnummer: CNA4523S
Alternativnummer: MBL-CNA4523S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 649-748 of human STAT4 (NP_003142.1).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1071]
Molekulargewicht: 86kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MAENIPENPLKYLYPDIPKDKAFGKHYSSQPCEVSRPTERGDKGYVPSVFIPISTIRSDSTEPHSPSDLLPMSPSVYAVLRENLSPTTIETAMKSPYSAE
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 649-748 of human STAT4 (NP_003142.1).
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000