CSTF2T Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA4540S
Artikelname: CSTF2T Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA4540S
Hersteller Artikelnummer: CNA4540S
Alternativnummer: MBL-CNA4540S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 420-560 of human CSTF2T (NP_056050.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 64kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: TRAMETEVLETRVMERRGMETCAMETRGMEARGMDARGLEMRGPVPSSRGPMTGGIQGPGPINIGAGGPPQGPRQVPGISGVGNPGAGMQGTGIQGTGMQGAGIQGGGMQGAGIQGVSIQGGGIQGGGIQGASKQGGSQPS
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 420-560 of human CSTF2T (NP_056050.1).
Application Verdünnung: WB: WB,1:1000 - 1:2000|IF/ICC,1:50 - 1:200