GSR Rabbit mAb, Clone: [ARC1034], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA4566S
Artikelname: GSR Rabbit mAb, Clone: [ARC1034], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA4566S
Hersteller Artikelnummer: CNA4566S
Alternativnummer: MBL-CNA4566S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 423-522 of human GSR (P00390).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1034]
Molekulargewicht: 56kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: TVGLTEDEAIHKYGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 423-522 of human GSR (P00390).
Application Verdünnung: WB: WB,1:500 - 1:1000