[KO Validated] Histone H2A.Z Rabbit mAb, Clone: [ARC1048], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA4599S
Artikelname: [KO Validated] Histone H2A.Z Rabbit mAb, Clone: [ARC1048], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA4599S
Hersteller Artikelnummer: CNA4599S
Alternativnummer: MBL-CNA4599S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ChIP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H2A.Z (P0C0S5).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1048]
Molekulargewicht: 13kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSL
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H2A.Z (P0C0S5).
Application Verdünnung: WB: WB,1:1000 - 1:5000|ChIP,1:50 - 1:200