SAMHD1 Rabbit mAb, Clone: [ARC1050], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA4607S
Artikelname: SAMHD1 Rabbit mAb, Clone: [ARC1050], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA4607S
Hersteller Artikelnummer: CNA4607S
Alternativnummer: MBL-CNA4607S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 527-626 of human SAMHD1 (NP_056289.2).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1050]
Molekulargewicht: 72kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: NRAIRITKNQVSQLLPEKFAEQLIRVYCKKVDRKSLYAARQYFVQWCADRNFTKPQDGDVIAPLITPQKKEWNDSTSVQNPTRLREASKSRVQLFKDDPM
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 527-626 of human SAMHD1 (NP_056289.2).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200