ACE2 Rabbit mAb, Clone: [ARC50948], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA4612P
Artikelname: ACE2 Rabbit mAb, Clone: [ARC50948], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA4612P
Hersteller Artikelnummer: CNA4612P
Alternativnummer: MBL-CNA4612P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 18-740 of human ACE2 (NP_068576.1).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC50948]
Molekulargewicht: 92kDa
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: QSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMW
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 18-740 of human ACE2 (NP_068576.1).
Application Verdünnung: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200