MYCBP Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA4623T
Artikelname: MYCBP Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA4623T
Hersteller Artikelnummer: CNA4623T
Alternativnummer: MBL-CNA4623T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-103 of human MYCBP (NP_036465.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 12kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1-103 of human MYCBP (NP_036465.2).
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200