[KO Validated] MTA2 Rabbit mAb, Clone: [ARC1056], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA4624S
Artikelname: [KO Validated] MTA2 Rabbit mAb, Clone: [ARC1056], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA4624S
Hersteller Artikelnummer: CNA4624S
Alternativnummer: MBL-CNA4624S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ChIP, ICC, IF, IHC-P, IP, WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 569-668 of human MTA2 (O94776).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1056]
Molekulargewicht: 75kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: GVPFSANGRPLASGIRSSSQPAAKRQKLNPADAPNPVVFVATKDTRALRKALTHLEMRRAARRPNLPLKVKPTLIAVRPPVPLPAPSHPASTNEPIVLED
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 569-668 of human MTA2 (O94776).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:100 - 1:500|ChIP,1:100 - 1:500