TPPP/p25 Rabbit mAb, Clone: [ARC1129], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA4637S
Artikelname: TPPP/p25 Rabbit mAb, Clone: [ARC1129], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA4637S
Hersteller Artikelnummer: CNA4637S
Alternativnummer: MBL-CNA4637S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human TPPP/p25 (O94811).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1129]
Molekulargewicht: 24kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: FSKIKGKSCRTITFEQFQEALEELAKKRFKDKSSEEAVREVHRLIEGKAPIISGVTKAISSPTVSRLTDTTKFTGSHKERFDPSGKGKGKAGRVDLVDESG
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human TPPP/p25 (O94811).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200