IRAK2 Rabbit mAb, Clone: [ARC1078], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA4655S
Artikelname: IRAK2 Rabbit mAb, Clone: [ARC1078], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA4655S
Hersteller Artikelnummer: CNA4655S
Alternativnummer: MBL-CNA4655S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 50-250 of human IRAK2 (O43187).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1078]
Molekulargewicht: 69kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: RVQGVSITRELLWWWGMRQATVQQLVDLLCRLELYRAAQIILNWKPAPEIRCPIPAFPDSVKPEKPLAASVRKAEDEQEEGQPVRMATFPGPGSSPARAHQPAFLQPPEEDAPHSLRSDLPTSSDSKDFSTSIPKQEKLLSLAGDSLFWSEADVVQATDDFNQNRKISQGTFADVYRGHRHGKPFVFKKLRETACSSPGSI
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 50-250 of human IRAK2 (O43187).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200