MRPS28 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA4660T
Artikelname: MRPS28 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA4660T
Hersteller Artikelnummer: CNA4660T
Alternativnummer: MBL-CNA4660T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-187 of human MRPS28 (NP_054737.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 21kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MAALCRTRAVAAESHFLRVFLFFRPFRGVGTESGSESGSSNAKEPKTRAGGFASALERHSELLQKVEPLQKGSPKNVESFASMLRHSPLTQMGPAKDKLVIGRIFHIVENDLYIDFGGKFHCVCRRPEVDGEKYQKGTRVRLRLLDLELTSRFLGATTDTTVLEANAVLLGIQESKDSRSKEEHHEK
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1-187 of human MRPS28 (NP_054737.1).
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:20 - 1:100