LOXL2 Rabbit mAb, Clone: [ARC1100], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA4708S
Artikelname: LOXL2 Rabbit mAb, Clone: [ARC1100], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA4708S
Hersteller Artikelnummer: CNA4708S
Alternativnummer: MBL-CNA4708S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 675-774 of human LOXL2 (Q9Y4K0).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1100]
Molekulargewicht: 87kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: NFGDQGITMGCWDMYRHDIDCQWVDITDVPPGDYLFQVVINPNFEVAESDYSNNIMKCRSRYDGHRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQLSPQ
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 675-774 of human LOXL2 (Q9Y4K0).
Application Verdünnung: WB: WB,1:500 - 1:1000