Troponin I2 (TNNI2) Rabbit mAb, Clone: [ARC1114], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA4740S
Artikelname: Troponin I2 (TNNI2) Rabbit mAb, Clone: [ARC1114], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA4740S
Hersteller Artikelnummer: CNA4740S
Alternativnummer: MBL-CNA4740S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 83-182 of human Troponin I2 (Troponin I2 (TNNI2)) (P48788).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1114]
Molekulargewicht: 21kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: EVRVQKTSKELEDMNQKLFDLRGKFKRPPLRRVRMSADAMLKALLGSKHKVCMDLRANLKQVKKEDTEKERDLRDVGDWRKNIEEKSGMEGRKKMFESES
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 83-182 of human Troponin I2 (Troponin I2 (TNNI2)) (P48788).
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200