ERK1/2 Rabbit mAb, Clone: [ARC0212], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA4782P
Artikelname: ERK1/2 Rabbit mAb, Clone: [ARC0212], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA4782P
Hersteller Artikelnummer: CNA4782P
Alternativnummer: MBL-CNA4782P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 180-360 of human ERK2 (P28482).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0212]
Molekulargewicht: 42,44kDa
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: HTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 180-360 of human ERK2 (P28482).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000