HAUS6 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA4797S
Artikelname: HAUS6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA4797S
Hersteller Artikelnummer: CNA4797S
Alternativnummer: MBL-CNA4797S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 676-955 of human HAUS6 (NP_060115.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 109kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: DEPPTQNQSDLLNKKVICKQDLECLAFTKLSETSRMETFSPAVGNRIDVMGGSEEEFMKILDHLEVSCNKPSTNKTMLWNSFQISSGISSKSFKDNDFGILHETLPEEVGHLSFNSSSSSEANFKLEPNSPMHGGTLLEDVVGGRQTTPESDFNLQALRSRYEALKKSLSKKREESYLSNSQTPERHKPELSPTPQNVQTDDTLNFLDTCDLHTEHIKPSLRTSIGERKRSLSPLIKFSPVEQRLRTTIACSLG
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 676-955 of human HAUS6 (NP_060115.3).
Application Verdünnung: WB: WB,1:500 - 1:2000