CC2D1A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA4800T
Artikelname: CC2D1A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA4800T
Hersteller Artikelnummer: CNA4800T
Alternativnummer: MBL-CNA4800T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human CC2D1A (NP_060191.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 104kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MHKRKGPPGPPGRGAAAARQLGLLVDLSPDGLMIPEDGANDEELEAEFLALVGGQPPALEKLKGKGPLPMEAIEKMASLCMRDPDEDEEEGTDEDDLEADDDLLAELNEVLGEEQKASETPPPVAQPKPEAPHPGLETTLQERLALYQTA
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human CC2D1A (NP_060191.3).
Application Verdünnung: WB: WB,1:1000 - 1:2000|IHC-P,1:50 - 1:200