Collagen XVII/COL17A1 Rabbit mAb, Clone: [ARC0233], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA4808S
Artikelname: Collagen XVII/COL17A1 Rabbit mAb, Clone: [ARC0233], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA4808S
Hersteller Artikelnummer: CNA4808S
Alternativnummer: MBL-CNA4808S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1300-1400 of human Collagen XVII/COL17A1 (Q9UMD9).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0233]
Molekulargewicht: 150kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: SVRRGSSYSSSMSTGGGGAGSLGAGGAFGEAAGDRGPYGTDIGPGGGYGAAAEGGMYAGNGGLLGADFAGDLDYNELAVRVSESMQRQGLLQGMAYTVQGP
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 1300-1400 of human Collagen XVII/COL17A1 (Q9UMD9).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200