DNAJC15 Rabbit mAb, Clone: [ARC0249], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA4825S
Artikelname: DNAJC15 Rabbit mAb, Clone: [ARC0249], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA4825S
Hersteller Artikelnummer: CNA4825S
Alternativnummer: MBL-CNA4825S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 70-150 of human DNAJC15 (Q9Y5T4).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0249]
Molekulargewicht: 16kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: ETAKKISTPSFSSYYKGGFEQKMSRREAGLILGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVAAKINEAKDLLETTTKH
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 70-150 of human DNAJC15 (Q9Y5T4).
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200