Pan Cadherin Rabbit mAb, Clone: [ARC1135], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA4903S
Artikelname: Pan Cadherin Rabbit mAb, Clone: [ARC1135], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA4903S
Hersteller Artikelnummer: CNA4903S
Alternativnummer: MBL-CNA4903S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 806-906 of human Cadherin-2 (CDH2) (P19022).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1135]
Molekulargewicht: 140kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: IRRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADMYGGGDD
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 806-906 of human Cadherin-2 (CDH2) (P19022).
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200